Protein Info for MMP_RS06370 in Methanococcus maripaludis S2

Annotation: biotin synthase BioB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00433: biotin synthase
  • amino acids 30 to 326 (297 residues), 330.9 bits, E=3.5e-103
• PF04055: Radical_SAM
  • amino acids 65 to 220 (156 residues), 72.2 bits, E=5.9e-24
• PF06968: BATS
  • amino acids 232 to 326 (95 residues), 72.9 bits, E=2e-24

Best Hits

Swiss-Prot: 100% identical to BIOB_METMP: Biotin synthase (bioB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 100% identity to mmp:MMP1238)

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis II (5/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)
• biotin biosynthesis I (5/15 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.6

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

See Q6LXV8 at UniProt or InterPro

Protein Sequence (327 amino acids)

>MMP_RS06370 biotin synthase BioB (Methanococcus maripaludis S2)
LKEIKLNSDSLEIYEKSVSEKLNRNDFIKLWDLDLNDLLDISYNLKKLFNKEKIDLCSIM
NAKSGICPENCIFCSQSKHNTSKIDTYGLKSKEEILKNAKSVEKYSNRFSIVVSGKTVTD
LEFEKIIESIEEIQNKTKLRVCVSLGLLNKDKLKALKERNVRIHNNLETSENYFKNICTS
HDYSEKIKVILEAKKIGLEMCSGGIFGMGETIEDRVDLFLDLKKLGVDSVALNLLNPIYG
TKIYEKIKSGDISPINSTDALKSICIARIALPNKVIRLCGGREHVLKDMQKYSLLALDGL
MIGNYLTTNGQNIQSDLKMIEEMGFER