Protein Info for MMP_RS06370 in Methanococcus maripaludis S2

Annotation: biotin synthase BioB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 TIGR00433: biotin synthase" amino acids 30 to 326 (297 residues), 330.9 bits, see alignment E=3.5e-103 PF04055: Radical_SAM" amino acids 65 to 220 (156 residues), 73.2 bits, see alignment E=3e-24 PF06968: BATS" amino acids 232 to 326 (95 residues), 72.3 bits, see alignment E=3e-24

Best Hits

Swiss-Prot: 100% identical to BIOB_METMP: Biotin synthase (bioB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 100% identity to mmp:MMP1238)

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.6

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXV8 at UniProt or InterPro

Protein Sequence (327 amino acids)

>MMP_RS06370 biotin synthase BioB (Methanococcus maripaludis S2)
LKEIKLNSDSLEIYEKSVSEKLNRNDFIKLWDLDLNDLLDISYNLKKLFNKEKIDLCSIM
NAKSGICPENCIFCSQSKHNTSKIDTYGLKSKEEILKNAKSVEKYSNRFSIVVSGKTVTD
LEFEKIIESIEEIQNKTKLRVCVSLGLLNKDKLKALKERNVRIHNNLETSENYFKNICTS
HDYSEKIKVILEAKKIGLEMCSGGIFGMGETIEDRVDLFLDLKKLGVDSVALNLLNPIYG
TKIYEKIKSGDISPINSTDALKSICIARIALPNKVIRLCGGREHVLKDMQKYSLLALDGL
MIGNYLTTNGQNIQSDLKMIEEMGFER