Protein Info for MMP_RS06355 in Methanococcus maripaludis S2

Annotation: molybdenum cofactor biosynthesis protein MoaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF02391: MoaE" amino acids 5 to 122 (118 residues), 114.7 bits, see alignment E=1.4e-37

Best Hits

Swiss-Prot: 44% identical to MOAE_PYRAB: Molybdopterin synthase catalytic subunit (moaE) from Pyrococcus abyssi (strain GE5 / Orsay)

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 100% identity to mmp:MMP1235)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXW1 at UniProt or InterPro

Protein Sequence (141 amino acids)

>MMP_RS06355 molybdenum cofactor biosynthesis protein MoaE (Methanococcus maripaludis S2)
MIRVSNEDFNVDVETKALLKNHPEIGGLVNFVGVVRNVGYDKGVEKEAEFIEFECYEQMA
SKKLEELKNRAIEKFNIIDATLIHRIGTLKVGDNIVLIVVGAKHRKEAFLACEYLIDSLK
EEVPIWKKEFSKDGSYWVEQH