Protein Info for MMP_RS06350 in Methanococcus maripaludis S2

Annotation: HesA/MoeB/ThiF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00899: ThiF
  • amino acids 6 to 232 (227 residues), 229.2 bits, E=1.8e-72

Best Hits

Swiss-Prot: 40% identical to HESA1_ANAVT: Protein HesA, heterocyst (hesA1) from Anabaena variabilis (strain ATCC 29413 / PCC 7937)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1234)

MetaCyc: 39% identical to sulfur carrier protein ThiS adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-9789 [EC: 2.7.7.73]

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (5/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (5/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (1/6 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (1/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.73

Sequence Analysis Tools

See Q6LXW2 at UniProt or InterPro

Protein Sequence (239 amino acids)

>MMP_RS06350 HesA/MoeB/ThiF family protein (Methanococcus maripaludis S2)
MSLERYKRQILMDDFGELGQKKLLDATVTVVGVGGLGTVVSQYLAAAGVGNLKLVDYQEV
ELSNLNRQILHFEKDIGIKKVISAKEKLESINSEINIEIYPEKVNENHIKNSDVIIDCLD
NFEARYLLNNFSNKYKIPLVHGAIEDLRGQVTTIIPDETPCIECIFKLKDEEKNKSFPVL
GVTPGVIGSIQAGEAIKLIIGIGTPLKNKLLSINMRTNDYFTFNIKKNPKCKICGGLND