Protein Info for MMP_RS06340 in Methanococcus maripaludis S2

Annotation: phosphoadenosine phosphosulfate reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF02540: NAD_synthase" amino acids 35 to 133 (99 residues), 24.2 bits, see alignment E=3.3e-09 PF02568: ThiI" amino acids 39 to 152 (114 residues), 22.3 bits, see alignment E=1.8e-08 PF06508: QueC" amino acids 40 to 101 (62 residues), 23.4 bits, see alignment E=7.9e-09 PF01507: PAPS_reduct" amino acids 41 to 225 (185 residues), 26.7 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1232)

Predicted SEED Role

"TilS-like 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXW4 at UniProt or InterPro

Protein Sequence (296 amino acids)

>MMP_RS06340 phosphoadenosine phosphosulfate reductase family protein (Methanococcus maripaludis S2)
MDNNLEFRPWTQNKRNLKHLNQLKEDILNNFEELNLKDEKIIVMLSGGKDSAVSLAIAKD
LGLNVHLCVHFVHKWSWDISTNEAKKLADRFNVPIIFPDITEELAKKTQGAKGKSICRIC
KTIMKARMMDIAKVENAKIIMTGETALEKIAGPVFQYIRENNASVKRKDEFELYKKMEIT
KVPKRYKIHFFRPLIRVGHFDVFNLQKYYKIDIKRVSEAGNKIGYWREGCCLQYCSPTCE
LTTELFDDLYKINKKATEIARDCGFRASITLPAKEITVIPEEEKYLKKIEEILKEI