Protein Info for MMP_RS06315 in Methanococcus maripaludis S2
Annotation: cobalt-precorrin-7 (C(5))-methyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 58% identical to CBIE_METJA: Probable cobalt-precorrin-7 C(5)-methyltransferase (cbiE) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K03399, precorrin-6Y C5,15-methyltransferase [EC: 2.1.1.132] (inferred from 100% identity to mmp:MMP1227)Predicted SEED Role
"Cobalt-precorrin-6y C5-methyltransferase (EC 2.1.1.-)" in subsystem Coenzyme B12 biosynthesis (EC 2.1.1.-)
MetaCyc Pathways
- cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (14/15 steps found)
- adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
- cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (10/13 steps found)
- adenosylcobalamin biosynthesis II (aerobic) (24/33 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.132
Use Curated BLAST to search for 2.1.1.- or 2.1.1.132
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LXW9 at UniProt or InterPro
Protein Sequence (208 amino acids)
>MMP_RS06315 cobalt-precorrin-7 (C(5))-methyltransferase (Methanococcus maripaludis S2) VIYIVGIGPGSRDYVTEKAFDTVETSDFVLGSKRSLEIFEINGKRMELTLNLKNELYDFL KNYKNSNSKEKVSILSTGDPCFSGLLKTIFSFDFIDQNDFEVIPGISSIQMAAAKAKISW EDYNILTIHGKEENLKKLLDFVKNDEKVIFLPNNLKNDIKFLIENGISDEKEITVLENLS YSNERIITNKISNLVKNDYSYLLVCIIN