Protein Info for MMP_RS06285 in Methanococcus maripaludis S2

Annotation: precorrin-6Y C5 15-methyltransferase (decarboxylating) subunit CbiT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 TIGR02469: precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit" amino acids 14 to 129 (116 residues), 89.7 bits, see alignment E=9e-30 PF01135: PCMT" amino acids 15 to 89 (75 residues), 23.1 bits, see alignment E=2.6e-08 PF05175: MTS" amino acids 28 to 99 (72 residues), 24.3 bits, see alignment E=1e-08 PF02475: Met_10" amino acids 30 to 116 (87 residues), 21.1 bits, see alignment E=1.1e-07 PF13847: Methyltransf_31" amino acids 31 to 101 (71 residues), 37 bits, see alignment E=1.3e-12 PF03602: Cons_hypoth95" amino acids 34 to 120 (87 residues), 24.7 bits, see alignment E=7.8e-09 PF09445: Methyltransf_15" amino acids 35 to 101 (67 residues), 27.8 bits, see alignment E=8.1e-10 PF13649: Methyltransf_25" amino acids 36 to 103 (68 residues), 31.2 bits, see alignment E=1.3e-10 PF08241: Methyltransf_11" amino acids 37 to 92 (56 residues), 21.2 bits, see alignment E=1.6e-07

Best Hits

Swiss-Prot: 100% identical to CBIT_METMP: Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) (cbiT) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02191, precorrin-8W decarboxylase [EC: 1.-.-.-] (inferred from 100% identity to mmp:MMP1221)

Predicted SEED Role

"Cobalt-precorrin-6y C15-methyltransferase [decarboxylating] (EC 2.1.1.-)" in subsystem Coenzyme B12 biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 2.1.1.-

Use Curated BLAST to search for 1.-.-.- or 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61820 at UniProt or InterPro

Protein Sequence (181 amino acids)

>MMP_RS06285 precorrin-6Y C5 15-methyltransferase (decarboxylating) subunit CbiT (Methanococcus maripaludis S2)
MIQDSEFFRMEGVPITKEEIRAVSIGKLNLDPEDVVLDIGCGSGGMSVEISKRSKFVYSI
DNSEDAKNTTLNNLKKFNVENCTVSLGNAEDLISKFDFNKVFIGGTQNIEQILEILKEKN
IERIVVNTIVLENSVKIINKFEELGYNVDFVNVSVSYGKKINSGHIMLSKNPITIITATL
K