Protein Info for MMP_RS06235 in Methanococcus maripaludis S2

Annotation: hydroxymethylglutaryl-CoA synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00748: putative hydroxymethylglutaryl-CoA synthase
  • amino acids 4 to 349 (346 residues), 603.7 bits, E=5.7e-186
• PF08541: ACP_syn_III_C
  • amino acids 222 to 302 (81 residues), 40.6 bits, E=1.2e-14

Best Hits

Swiss-Prot: 100% identical to Y1211_METMP: UPF0219 protein MMP1211 (MMP1211) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1211)

MetaCyc: 81% identical to hydroxymethylglutaryl-CoA synthase (Methanothermococcus thermolithotrophicus)
Hydroxymethylglutaryl-CoA synthase. [EC: 2.3.3.10]

Predicted SEED Role

"Hydroxymethylglutaryl-CoA synthase (EC 2.3.3.10)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis or Ketoisovalerate oxidoreductase or Leucine Degradation and HMG-CoA Metabolism (EC 2.3.3.10)

MetaCyc Pathways

• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (8/10 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (5/7 steps found)
• mevalonate pathway II (haloarchaea) (5/7 steps found)
• isoprene biosynthesis II (engineered) (5/8 steps found)
• mevalonate pathway IV (archaea) (5/8 steps found)
• ketogenesis (2/5 steps found)
• mevalonate pathway III (Thermoplasma) (4/8 steps found)
• ferrichrome A biosynthesis (1/5 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)
• superpathway of ergosterol biosynthesis I (7/26 steps found)
• superpathway of cholesterol biosynthesis (7/38 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Synthesis and degradation of ketone bodies
• Terpenoid biosynthesis
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.10

Sequence Analysis Tools

See Q6LXY3 at UniProt or InterPro

Protein Sequence (349 amino acids)

>MMP_RS06235 hydroxymethylglutaryl-CoA synthase (Methanococcus maripaludis S2)
MKEVGIVGYGSDLPKYRIKAEDIAGAWGKDAQAIKRGLVVNEKSVPGPDEDTATIAVQSA
RRALSRAGINPKDIGAVYVGSESHPYAVKPTSGIVAEACGVSPDFTAADLEFACKAGTAG
IQMCMGLVGSEMMEYAMAVGADTAQGAPGDALEYTAAAGGAAFIIGAKKEEFIAKFNGTY
SYTTDTPDFWRREHEHYPKHGGRFTGEPAYFKHVLNGAKGMMEKMGTTSKDYDYCVFHQP
NGKFYLTAAKKLGFTEEQYKYGLLTPYLGNTYSGAVPLGLSNILDHAKADDRIFVVSYGS
GAGSDAFDITVTDRISEVVDKEITTEKLLEQKKYVDYAVYLKYRGKIRM