Protein Info for MMP_RS06220 in Methanococcus maripaludis S2

Annotation: translation initiation factor IF-2 subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 TIGR03680: translation initiation factor 2, gamma subunit" amino acids 5 to 409 (405 residues), 697.2 bits, see alignment E=8.4e-214 TIGR00231: small GTP-binding protein domain" amino acids 7 to 195 (189 residues), 61.9 bits, see alignment E=6.4e-21 PF00009: GTP_EFTU" amino acids 9 to 200 (192 residues), 118.2 bits, see alignment E=3.5e-38 PF09173: eIF2_C" amino acids 325 to 409 (85 residues), 113.3 bits, see alignment E=5.1e-37

Best Hits

Swiss-Prot: 100% identical to IF2G_METMP: Translation initiation factor 2 subunit gamma (eif2g) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03242, translation initiation factor 2 subunit 3 (inferred from 100% identity to mmp:MMP1208)

Predicted SEED Role

"Eukaryotic translation initiation factor 2 gamma subunit" in subsystem Translation initiation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXY6 at UniProt or InterPro

Protein Sequence (410 amino acids)

>MMP_RS06220 translation initiation factor IF-2 subunit gamma (Methanococcus maripaludis S2)
MAASNQSEVNIGMVGHVDHGKTSLTRKLTGVWTDTHSEELKRGISIRLGYADCEIKKCET
CDEPECYTVGKKCDSCGGKLQTLRKISFVDAPGHETLMATMLSGASLMDGAILVIAASEE
CPQPQTKEHLMALDALGVEKIIIVQNKIDLVSEEAAVENYNQIKEFTKGTVAENAPIIPV
SAHHGANLDVLLKAIQDFIPTPERDETVSPKLYVARSFDVNKPGSEIKDLKGGVIGGSII
QGALKVGDELEIKPGIKVTEGNKTHWVPIITKIISLGVGSKKLKTAYPGGLIGVGTELDP
NLTKSDALSGSLAGIPGTLPETLEKMEIEPQLLERVVGSQDELVIEPLKTNEVLMLNVGT
STTVGVTVSARPDRAEIKLKLPVCADKGDRVAISRKIGSRWRLIGYGIIL