Protein Info for MMP_RS06200 in Methanococcus maripaludis S2

Annotation: M24 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00557: Peptidase_M24
  • amino acids 123 to 324 (202 residues), 193.8 bits, E=1.7e-61

Best Hits

Swiss-Prot: 55% identical to Y806_METJA: Uncharacterized peptidase MJ0806 (MJ0806) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01271, Xaa-Pro dipeptidase [EC: 3.4.13.9] (inferred from 100% identity to mmp:MMP1204)

Predicted SEED Role

"Aminopeptidase YpdF (MP-, MA-, MS-, AP-, NP- specific)" in subsystem Protein degradation

MetaCyc Pathways

• glutathione degradation (DUG pathway) (1/2 steps found)
• γ-glutamyl cycle (1/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.13.9

Sequence Analysis Tools

See Q6LXY9 at UniProt or InterPro

Protein Sequence (339 amino acids)

>MMP_RS06200 M24 family metallopeptidase (Methanococcus maripaludis S2)
MDKFQEFLEYLKENDIKKAVIIKKENINYFLEKYPPNFSMLIFDTKKDTAILQVSKLDFE
MAKGYKNKNLDIELYENFESTFKECNGIEDSLPIRFLKFVKDYKLVSKKIEEMREIKTKA
EIENIKKAAKISDNAIEYATKLALENDNLTENQVAAEIEYFMKKNGSIRPSFDTIAISDK
KTRLPHGMPSNDLVKNILLMDIGALYEGYCSDITRTVILNENIKNYSEIYNVVNSVKNEA
ERNLKAGISVKELDLIAREHMGEFKDYFIHSLGHGVGVEIHENPAISSKIKEDVILKEGM
VITIEPGIYTNDFGVRIEDLYLVKKNGFEKLSNAKILEY