Protein Info for MMP_RS06175 in Methanococcus maripaludis S2

Annotation: winged helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF13412: HTH_24" amino acids 7 to 51 (45 residues), 24.6 bits, see alignment 1.5e-09 PF01895: PhoU" amino acids 83 to 166 (84 residues), 55.1 bits, see alignment E=8.1e-19

Best Hits

Swiss-Prot: 50% identical to Y1641_METJA: Uncharacterized protein MJ1641 (MJ1641) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02039, phosphate transport system protein (inferred from 100% identity to mmp:MMP1199)

Predicted SEED Role

"Phosphate transport system regulatory protein PhoU" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXZ4 at UniProt or InterPro

Protein Sequence (284 amino acids)

>MMP_RS06175 winged helix-turn-helix transcriptional regulator (Methanococcus maripaludis S2)
MLRGKDATLAAIINIILDEEPETQDDIADRLGVSRRYVAKLLKPLVDGGAIMHPYVVNLE
KLKEFEEYIETDRYFKEIYETFDRMGTNVIQNIDNVFDSLKTHDLDIAKSIILEDYALNR
MEDEVNLVIKMKASKYMDMNSLMQVSNIAANIERCGDYLSNIAEEVVNGLLVDPTINKEV
FEIKEIISKMFTHAMNMVKSKTIETEIYELEGNLHKKLDTIMEKIAEHPDENLKDINQFI
QFGMFLKDVERFGDRCLKIFELGREFHHNIPKNVTTPEYVRNLK