Protein Info for MMP_RS06120 in Methanococcus maripaludis S2

Annotation: UPF0147 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03685: UPF0147
  • amino acids 11 to 89 (79 residues), 122 bits, E=4.2e-40

Best Hits

Swiss-Prot: 64% identical to Y1419_METJA: UPF0147 protein MJ1419 (MJ1419) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K09721, hypothetical protein (inferred from 97% identity to mmx:MmarC6_1485)

Predicted SEED Role

"UPF0147 protein PYRAB16980"

Sequence Analysis Tools

See Q6LY05 at UniProt or InterPro

Protein Sequence (91 amino acids)

>MMP_RS06120 UPF0147 family protein (Methanococcus maripaludis S2)
MFSAKKLSPADKLKNISSMLEEIVEDTTVPRNIRAAADNAKNALHNEEQELIVRSATAIQ
YLDDISEDPNMPIHTRTQIWGIVSELETIKN