Protein Info for MMP_RS06115 in Methanococcus maripaludis S2

Annotation: class II aldolase/adducin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF00596: Aldolase_II" amino acids 5 to 173 (169 residues), 175.4 bits, see alignment E=5.9e-56

Best Hits

Swiss-Prot: 100% identical to FUCA_METMP: L-fuculose phosphate aldolase (fucA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01628, L-fuculose-phosphate aldolase [EC: 4.1.2.17] (inferred from 100% identity to mmp:MMP1187)

MetaCyc: 60% identical to fuculose-1-phosphate aldolase subunit (Methanocaldococcus jannaschii)
L-fuculose-phosphate aldolase. [EC: 4.1.2.17]

Predicted SEED Role

"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY06 at UniProt or InterPro

Protein Sequence (180 amino acids)

>MMP_RS06115 class II aldolase/adducin family protein (Methanococcus maripaludis S2)
MDLTEFIKICRLLYDRKYVVGSGGNVSIRDGNLIYITPTGLSLGFLTKEDICIADLNGNI
IKGKPTSELNMHLKIYQNKDSINAVVHTHSMYCTAFSALDKKLKLVTPEAEMVVKKIAYV
DYFPCGSLELAENVSECIEDSIILKNHGIVTLGKDITEAYIKTEVLEEVAQLNYIMNNLK