Protein Info for MMP_RS06075 in Methanococcus maripaludis S2

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF01209: Ubie_methyltran" amino acids 37 to 144 (108 residues), 43.1 bits, see alignment E=1.6e-14 PF13489: Methyltransf_23" amino acids 37 to 144 (108 residues), 32.3 bits, see alignment E=3.7e-11 PF05175: MTS" amino acids 42 to 116 (75 residues), 27.3 bits, see alignment E=1.1e-09 PF06325: PrmA" amino acids 44 to 147 (104 residues), 23.9 bits, see alignment E=1.2e-08 PF13847: Methyltransf_31" amino acids 45 to 160 (116 residues), 47.2 bits, see alignment E=9.6e-16 PF08241: Methyltransf_11" amino acids 47 to 145 (99 residues), 76.4 bits, see alignment E=1e-24 PF08242: Methyltransf_12" amino acids 47 to 142 (96 residues), 42.4 bits, see alignment E=4.5e-14 PF13649: Methyltransf_25" amino acids 47 to 141 (95 residues), 68.5 bits, see alignment E=3.2e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1179)

Predicted SEED Role

"Methlytransferase, UbiE/COQ5 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY14 at UniProt or InterPro

Protein Sequence (218 amino acids)

>MMP_RS06075 class I SAM-dependent methyltransferase (Methanococcus maripaludis S2)
MSENKKKFDKKGAKNMDEISKTLFAPIYPIIAENIINRFGITAGNCIDIGSGPGALSIAL
AKQSDFSIRALDFSKHMNEIALKNIADADLNDRIQIVQGDVHNIPIEDNYADLIVSRGSV
FFWEDVTTAFREIYRILKSGGKTYIGGGFGNKELRDSISAEMIRKNPDWKEFNRKNISQE
NVERFQNVLDEIGVSSYEIILEDEGFWIIISKTDQEVI