Protein Info for MMP_RS05955 in Methanococcus maripaludis S2

Annotation: CoB--CoM heterodisulfide reductase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF13183: Fer4_8" amino acids 31 to 91 (61 residues), 43.5 bits, see alignment E=9.7e-15 PF13237: Fer4_10" amino acids 31 to 88 (58 residues), 31.9 bits, see alignment E=2.5e-11 TIGR03290: CoB--CoM heterodisulfide reductase, subunit C" amino acids 32 to 172 (141 residues), 225.8 bits, see alignment E=9.2e-72 PF13187: Fer4_9" amino acids 33 to 90 (58 residues), 38 bits, see alignment E=3.3e-13 PF13534: Fer4_17" amino acids 33 to 91 (59 residues), 32.1 bits, see alignment E=3.5e-11

Best Hits

Swiss-Prot: 100% identical to HDRC1_METMP: H(2)/formate:CoB-CoM heterodisulfide,ferredoxin reductase subunit C1 (hdrC1) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03390, heterodisulfide reductase subunit C [EC: 1.8.98.1] (inferred from 100% identity to mmp:MMP1154)

MetaCyc: 100% identical to CoB-CoM heterodisulfide reductase HdrC1 component (Methanococcus maripaludis)
RXN-18529 [EC: 1.8.98.6]

Predicted SEED Role

"CoB--CoM heterodisulfide reductase subunit C (EC 1.8.98.1)" in subsystem Anaerobic respiratory reductases or H2:CoM-S-S-HTP oxidoreductase or Methanogenesis (EC 1.8.98.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.98.1

Use Curated BLAST to search for 1.8.98.1 or 1.8.98.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY39 at UniProt or InterPro

Protein Sequence (192 amino acids)

>MMP_RS05955 CoB--CoM heterodisulfide reductase subunit C (Methanococcus maripaludis S2)
MVLKSSEFNPDFPKQIIESGEWIFGDHASSFQKCYQCGTCTGACPSGRITALRTRKLIRS
ALAGIDSILSGDDLWMCTTCYECYEKCPREVKITDIIKIIRNIAAEKGYIAEPHRKTSLL
VFKTGHAVPVNDEIKKARLAIGLTEIPPTTHKYPEALEIVRDIMEDLNFCKKVGICRETM
DLEPLNVQKSEE