Protein Info for MMP_RS05880 in Methanococcus maripaludis S2

Annotation: thiamine phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF02581: TMP-TENI" amino acids 9 to 185 (177 residues), 216.9 bits, see alignment E=1.4e-68 TIGR00693: thiamine-phosphate diphosphorylase" amino acids 9 to 197 (189 residues), 206.8 bits, see alignment E=9.7e-66

Best Hits

Swiss-Prot: 100% identical to THIE_METMP: Thiamine-phosphate synthase (thiE) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 100% identity to mmp:MMP1139)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61413 at UniProt or InterPro

Protein Sequence (207 amino acids)

>MMP_RS05880 thiamine phosphate synthase (Methanococcus maripaludis S2)
LKFKDKLKFYVITDSNYSDEVISVEESLKGGATSIQLRMKTSSTRKMIEVGNKLRKLTSE
YDALFFVNDRLDVAQAVNADGIHVGIDDMPVSKIKEIAPNLIIGASAYNLDEMKTAESEG
ADYLGVGAVYSTNTKLDARDLGINGLKNISKIANLPIVAIGGINHSNVENVLKCGVSGVA
VVSAIVGAENILKSAENMNELIKKYIK