Protein Info for MMP_RS05845 in Methanococcus maripaludis S2

Annotation: tRNA-intron lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF02778: tRNA_int_endo_N" amino acids 10 to 74 (65 residues), 63.7 bits, see alignment E=8.7e-22 TIGR00324: tRNA-intron lyase" amino acids 12 to 174 (163 residues), 146.8 bits, see alignment E=3.1e-47 PF01974: tRNA_int_endo" amino acids 85 to 169 (85 residues), 107.7 bits, see alignment E=2.5e-35

Best Hits

Swiss-Prot: 100% identical to ENDA_METMP: tRNA-splicing endonuclease (endA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01170, tRNA-intron endonuclease [EC: 3.1.27.9] (inferred from 100% identity to mmp:MMP1132)

Predicted SEED Role

"tRNA-intron endonuclease (EC 3.1.27.9)" in subsystem tRNA splicing (EC 3.1.27.9)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.27.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY59 at UniProt or InterPro

Protein Sequence (177 amino acids)

>MMP_RS05845 tRNA-intron lyase (Methanococcus maripaludis S2)
MMAKPKKTIPAKLSDERIVIYDKDGISRLNEKRYGELHENFLSLSFVEGLYLVSKNWISL
RDKNKKLLSFEELFDVAQNIDRKLCIRYLAYKDLRNRGYTVRTGLKYGSDFRLYERSNID
EIHSRYLVKVFSEEIPCEISEITGFVRVAHSVRKELIIAIVDADGSVVYYNMGYLKL