Protein Info for MMP_RS05825 in Methanococcus maripaludis S2

Annotation: peptidyl-prolyl cis-trans isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00160: Pro_isomerase" amino acids 40 to 197 (158 residues), 166.8 bits, see alignment E=2.4e-53

Best Hits

Swiss-Prot: 53% identical to PPIA_DICD3: Peptidyl-prolyl cis-trans isomerase A (rotA) from Dickeya dadantii (strain 3937)

KEGG orthology group: K03768, peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC: 5.2.1.8] (inferred from 100% identity to mmp:MMP1128)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiB (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY63 at UniProt or InterPro

Protein Sequence (203 amino acids)

>MMP_RS05825 peptidyl-prolyl cis-trans isomerase (Methanococcus maripaludis S2)
MDFKNAIFIIVASIVLLTSFSGCTESDSTTSNETGEIVYATIQTNYGNMTFELYPDKAPI
TVENFKKYAESGFYEGTIFHRVISDFMIQGGGFTANGTKKETLDPIKNEADNGLSNKRGT
IAMARTNIVDSATSQFFINTVDNSYLDYQNDQNYGYAVFGELTDGFDVLDKIENVATANN
GQYQNWPVEDVIIEKVTIDPIKK