Protein Info for MMP_RS05815 in Methanococcus maripaludis S2

Annotation: NOL1/NOP2/sun family putative RNA methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00446: NOL1/NOP2/sun family putative RNA methylase
  • amino acids 7 to 262 (256 residues), 311.8 bits, E=1.7e-97
• PF01189: Methyltr_RsmB-F
  • amino acids 71 to 261 (191 residues), 200.8 bits, E=4.7e-63
• PF01209: Ubie_methyltran
  • amino acids 75 to 142 (68 residues), 22 bits, E=2.3e-08
• PF13847: Methyltransf_31
  • amino acids 76 to 216 (141 residues), 45.5 bits, E=1.7e-15
• PF01728: FtsJ
  • amino acids 77 to 202 (126 residues), 30.9 bits, E=6.5e-11

Best Hits

Swiss-Prot: 62% identical to TRM4_METJA: tRNA (cytosine(48)-C(5))-methyltransferase (trm4) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1126)

Predicted SEED Role

"tRNA/RNA cytosine-C5-methylase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q6LY65 at UniProt or InterPro

Protein Sequence (265 amino acids)

>MMP_RS05815 NOL1/NOP2/sun family putative RNA methylase (Methanococcus maripaludis S2)
LENLQFIRVNTLKISSEELKTRLEEKGVNLEDTFLDYVFRVVKSPFSMGSTPEYLLGYYF
LQSISSIIPSITLNPSKDDEVLDMCAAPGGKTTHLAQLMENEGSILAVEINKNRLKSLRS
NINRMGFKNTLMINTNAVNIDKKLRFDKILLDAPCTGNEVKDSNRVKTKRDILFCAKRQV
ELFRTAIEVLKDGGELVYSTCSPEIEEDEDIVRYILKTNKNMELIELTVDDFPGINMIEG
EVKGTLKVIPPNEPFFIAKFRKTKN