Protein Info for MMP_RS05780 in Methanococcus maripaludis S2

Annotation: multidrug resistance efflux transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details PF13536: EmrE" amino acids 38 to 305 (268 residues), 376.4 bits, see alignment E=4e-117

Best Hits

Swiss-Prot: 54% identical to YJLA_BACSU: Uncharacterized protein YjlA (yjlA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1119)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY72 at UniProt or InterPro

Protein Sequence (314 amino acids)

>MMP_RS05780 multidrug resistance efflux transporter family protein (Methanococcus maripaludis S2)
MKSIILGILSSLFFASTFVLNRQMDLFGGDWIFSASLRYIFTLPFLLIILYGKNNIKKVI
FEIKNNFKEWFIWSNVGFVLFYAPLTFAGNYGPSWLIAGTWQITIIAGILVTPLFYSMIE
NNGNLEKVRNKIPKKSLFISLIILFGILLMQYSRITSVSINDLVLGFIPVIIAAFSYPLG
NRKTMEISGGKLTTFQRILGMTLCSMPAWILLLFYGLLRSGIPNNNQIMQSFIVALFSGI
IATWLFFKATDMVRKDMKKLAAVESTQSGEIVFSVLGELILLGGAFPDIFANLGLLVVIF
GMVIHSTYSSKLSN