Protein Info for MMP_RS05765 in Methanococcus maripaludis S2

Annotation: M42 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05343: Peptidase_M42
  • amino acids 44 to 338 (295 residues), 360.3 bits, E=6.5e-112
• PF01546: Peptidase_M20
  • amino acids 157 to 344 (188 residues), 37.6 bits, E=2.2e-13

Best Hits

Swiss-Prot: 72% identical to Y555_METJA: Putative aminopeptidase MJ0555 (MJ0555) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01179, endoglucanase [EC: 3.2.1.4] (inferred from 100% identity to mmp:MMP1116)

Predicted SEED Role

"Uncharacterized hydrolase MJ0555"

MetaCyc Pathways

• cellulose degradation II (fungi) (1/3 steps found)

KEGG Metabolic Maps

• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.4

Sequence Analysis Tools

See Q6LY75 at UniProt or InterPro

Protein Sequence (350 amino acids)

>MMP_RS05765 M42 family metallopeptidase (Methanococcus maripaludis S2)
MSTLDYLKILATEKGISGREDNIREYMKKELEKYCDSIETDKFGNLIAKKGSTGPKIMIA
SHMDEIGLMVKYIDDKGFLKFTKIGGINDQMLLNQKVIVHGNNGDIVGVLGSKPPHKMKE
SERNKLISAEHMFIDIGAKNREEAEKMGVEIGTAMSFKSEFDNLGGNVVSCKSFDNRAGC
AVVLKTMELLKDMDLKCQVYAVGTVQEEVGLKGAKTSAFGINPDVAFALDVTICGDHPGI
KLEDAPVELGKGPVATIVDASGRGIITHPTVLRMVRDVSKADEIPVQYEVGEGGTTDATA
IHLTRDGIPTGVISVPSRYIHTPVEVIDTEDLEKTTELVVACIKKVHEYF