Protein Info for MMP_RS05725 in Methanococcus maripaludis S2

Annotation: magnesium/cobalt transporter CorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 257 to 277 (21 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 22 to 315 (294 residues), 285.3 bits, see alignment E=3.4e-89 PF01544: CorA" amino acids 25 to 309 (285 residues), 198 bits, see alignment E=1.1e-62

Best Hits

Swiss-Prot: 61% identical to CORA_METJA: Cobalt/magnesium transport protein CorA (corA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 100% identity to mmp:MMP1108)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY83 at UniProt or InterPro

Protein Sequence (316 amino acids)

>MMP_RS05725 magnesium/cobalt transporter CorA (Methanococcus maripaludis S2)
MLEIIGYHAGSFEVLNLDDVNSEHDLIWIDCYDPSDVELIELSKKIEIETDELSLGLDEQ
EVPRVEEEDTYYTIIFKAPLFEEDITTTSFGLYVKDNIILTIHADKIKSIGRLYNLVKTK
KPRTLLDKGKGFFIYTILNQITISYSRILVNLEDQLDVFEDRIVQEQNKNMTEEILQLRK
MLVYFHKALISNKDVISVLKRKYLSITTQEDRWEFEDLYYDILQLIDMETTYRELLSSMM
DMSLSIENIRMNQVMKILTMITALFAVPMWITGIYGMNFKYMPLSESPYGFWVISLVSIV
FILVISRIFVKEKWIK