Protein Info for MMP_RS05705 in Methanococcus maripaludis S2
Annotation: aspartate carbamoyltransferase regulatory subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to PYRI_METMP: Aspartate carbamoyltransferase regulatory chain (pyrI) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K00610, aspartate carbamoyltransferase regulatory subunit (inferred from 100% identity to mmp:MMP1104)Predicted SEED Role
"Aspartate carbamoyltransferase regulatory chain (PyrI)" in subsystem De Novo Pyrimidine Synthesis
MetaCyc Pathways
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
- superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
- UMP biosynthesis II (6/6 steps found)
- superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
- UMP biosynthesis I (5/6 steps found)
- UMP biosynthesis III (5/6 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LY87 at UniProt or InterPro
Protein Sequence (148 amino acids)
>MMP_RS05705 aspartate carbamoyltransferase regulatory subunit (Methanococcus maripaludis S2) MKRELKVKPIENGTVIDHISGSKALKVYKILNIEEKLPITLALNVPSKKGVTKDILKIEG LELSKDDVNKIALISPDATINIIKEGKVIKKFKVDIPKRIDGIIKCTNPNCITNKENIES RFSIEQKNTLKIRCEYCEKFINSIIISK