Protein Info for MMP_RS05675 in Methanococcus maripaludis S2

Annotation: phosphate ABC transporter ATP-binding protein PstB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 5 to 251 (247 residues), 429.7 bits, see alignment E=1.5e-133 PF00005: ABC_tran" amino acids 20 to 175 (156 residues), 110.5 bits, see alignment E=1e-35

Best Hits

Swiss-Prot: 100% identical to PSTB_METMP: Phosphate import ATP-binding protein PstB (pstB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 100% identity to mmp:MMP1098)

MetaCyc: 58% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY93 at UniProt or InterPro

Protein Sequence (251 amino acids)

>MMP_RS05675 phosphate ABC transporter ATP-binding protein PstB (Methanococcus maripaludis S2)
MKIKMNSKDVNFWYGEKKALNDINLPIYENKITALIGPSGCGKSTFLRCLNRMNDLISGV
KITGEITLDEKNIYDKDVDVVELRKRVGMVFQKPNPFPMSIYDNIAYGPRIHGIKDKKQL
DEIVEWALKKSALWDDVKEDLKKSALKLSGGQQQRLCIARTIAVKPDVILMDEPCSALDP
ISTLKIEDLMVELKKEYTIVIVTHNMQQASRVSDYTGFFMLGDLVEFNKTDKLFVEPENK
KTEDYISGRFG