Protein Info for MMP_RS05670 in Methanococcus maripaludis S2

Annotation: phosphate ABC transporter permease PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 13 to 38 (26 residues), see Phobius details amino acids 72 to 98 (27 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 12 to 284 (273 residues), 260.5 bits, see alignment E=7.6e-82 PF00528: BPD_transp_1" amino acids 88 to 280 (193 residues), 65.4 bits, see alignment E=2.8e-22

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to mmp:MMP1097)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY94 at UniProt or InterPro

Protein Sequence (288 amino acids)

>MMP_RS05670 phosphate ABC transporter permease PstA (Methanococcus maripaludis S2)
LNNSKKAKIEEKIVFGIFYLFAFIVVGILSTIVGYVFINGIGAINMEFFFGDSNPINVIL
GFERSFDGIWNSIIGTLALVVLSILLSIPFGVLGAIYLHEYASDNKLTQAIRFSSDSLAG
LPSIVFGIFGYALAIKTVGPSLLIGGLTLSFMVLPIIMRATEEGLKSVAPGLREGSLALG
ATKWQTITKVVIPSALPQMITGIILAMGRSAEETAAIMFTAATAFSFGIGLFNRVETLSF
SLYVLSTEYSNAEELKMAYGIALVLIAIMFVLFTIANVVKNRFKLMQS