Protein Info for MMP_RS05665 in Methanococcus maripaludis S2

Annotation: phosphate ABC transporter permease subunit PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 64 to 94 (31 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 11 to 286 (276 residues), 307.1 bits, see alignment E=1.1e-95 TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 16 to 287 (272 residues), 198.2 bits, see alignment E=1.5e-62 PF00528: BPD_transp_1" amino acids 86 to 287 (202 residues), 96.7 bits, see alignment E=7.5e-32

Best Hits

Swiss-Prot: 43% identical to YQGH_BACSU: Probable ABC transporter permease protein YqgH (yqgH) from Bacillus subtilis (strain 168)

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to mmp:MMP1096)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY95 at UniProt or InterPro

Protein Sequence (291 amino acids)

>MMP_RS05665 phosphate ABC transporter permease subunit PstC (Methanococcus maripaludis S2)
MHKKNIGESVLENILKLSALLSSVIIFAMVLFLILSSLPVFSVVNPLDFVLGSDWSPIND
AYGIFPMIVGSFLVTVLALVFSVPLGVGCAIFLAELAPKKVQNILRPSIEILTAIPSVVY
GFVGMVLLVPLIRDVFNTNPGYSWLAASIILGIMIVPTITVLSEDAINSVPQQLKEGSLA
MGATRWQTIKKVVLPASLSGILSGVILGMGRAIGETMAVLMVAGNWPLIPKSIFDPVRPL
TSHIILNIKEAASGSPIYYAMFATGLVLFVMVLSLNLISHYINKKYKIKWD