Protein Info for MMP_RS05635 in Methanococcus maripaludis S2

Annotation: NAD-dependent epimerase/dehydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 2 to 173 (172 residues), 52.7 bits, E=1.4e-17
• PF05368: NmrA
  • amino acids 3 to 151 (149 residues), 29.4 bits, E=2.2e-10
• PF02719: Polysacc_synt_2
  • amino acids 3 to 250 (248 residues), 51 bits, E=5e-17
• PF01370: Epimerase
  • amino acids 3 to 230 (228 residues), 212.2 bits, E=3.1e-66
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 291 (288 residues), 191.8 bits, E=9e-60
• PF01073: 3Beta_HSD
  • amino acids 4 to 220 (217 residues), 96.8 bits, E=4.7e-31
• PF07993: NAD_binding_4
  • amino acids 5 to 215 (211 residues), 40.1 bits, E=1e-13
• PF13460: NAD_binding_10
  • amino acids 7 to 167 (161 residues), 35.5 bits, E=3.9e-12

Best Hits

Swiss-Prot: 72% identical to GALE_METJA: Putative UDP-glucose 4-epimerase (MJ0211) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to mmp:MMP1090)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (3/7 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (9/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See Q6LYA1 at UniProt or InterPro

Protein Sequence (292 amino acids)

>MMP_RS05635 NAD-dependent epimerase/dehydratase family protein (Methanococcus maripaludis S2)
LKILVTGGAGFIGSHIVDMLIENGHDVSILDNLSTGNEKNLNSSAKFINGDILDKNLDLT
GFECVIHEAAQINVRTSVENPSLDANINILGTVNILEKMKEYGVKKIIFSSSGGAVYGEP
EYLPVDEKHSLKPLSPYGLSKFCAEEYIKLYNMLYDIEYCILRYSNVYGERQDPLGEAGV
ISIFIDKMKKGEVPVIYGDGNQTRDFVNVKDVARANLMALNWKNEIVNIGSGKETSVNEL
FKIISSEIGFDKDPIYKKEREGEVYKIYIDYSKAKSLGWMPEVELDDGIKKI