Protein Info for MMP_RS05600 in Methanococcus maripaludis S2
Annotation: AglZ/HisF2 family acetamidino modification protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to HIS62_PSEAE: Putative imidazole glycerol phosphate synthase subunit hisF2 (hisF2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 100% identity to mmp:MMP1083)MetaCyc: 32% identical to imidazole glycerol phosphate synthase subunit HisF (Escherichia coli K-12 substr. MG1655)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]
Predicted SEED Role
"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
- L-histidine biosynthesis (9/10 steps found)
- L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
- glutaminyl-tRNAgln biosynthesis via transamidation (4/4 steps found)
- ammonia assimilation cycle III (3/3 steps found)
- L-glutamate biosynthesis I (2/2 steps found)
- L-glutamine degradation I (1/1 steps found)
- L-citrulline biosynthesis (4/8 steps found)
- L-glutamate and L-glutamine biosynthesis (3/7 steps found)
- superpathway of L-citrulline metabolism (6/12 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Pyruvate metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.1.3.-
Use Curated BLAST to search for 4.1.3.- or 4.3.2.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LYA8 at UniProt or InterPro
Protein Sequence (244 amino acids)
>MMP_RS05600 AglZ/HisF2 family acetamidino modification protein (Methanococcus maripaludis S2) MYRNRIIPCLLLKDERLVKTVKFKDPNYIGDPLNAVRIFNDKEADELFFIDISASKRESI NFDLLKKISSQSFMPLGYAGGIKCLNDAKKIFSIGFEKISLNTIVLKNPDLITEISKIYG SQSVLVTIDVKKNFFGKYYVYNHLKKKITKYNPVDFARKMEVLGAGELVINCVDNDGVMK GYNLKLIGEISKAVKIPIVALGGAGSLKDLDDAINVGASAAGAGSLFIYYGPHKAVLINY PRGD