Protein Info for MMP_RS05560 in Methanococcus maripaludis S2

Annotation: deoxyuridine 5'-triphosphate nucleotidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF22769: DCD" amino acids 14 to 141 (128 residues), 81.4 bits, see alignment E=8.3e-27 PF00692: dUTPase" amino acids 70 to 143 (74 residues), 22.6 bits, see alignment E=7.6e-09

Best Hits

Swiss-Prot: 65% identical to DUT_METJA: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 99% identity to mmz:MmarC7_0328)

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYB6 at UniProt or InterPro

Protein Sequence (156 amino acids)

>MMP_RS05560 deoxyuridine 5'-triphosphate nucleotidohydrolase (Methanococcus maripaludis S2)
MIIGPNITKDFLSDLKEGQLQQCGVDLKLDKIYKIEGKGAIDFSNEKRVLPEHVLIFDSE
KDEKIDLECGIYIVKIKEKMNIPENMAGFAYPRSTLLRMGVTLYTAVHDPGYEGYASYLM
HVMNPVTMYKYAKIAQIVFSEVKDGNGTYSGIYHKK