Protein Info for MMP_RS05540 in Methanococcus maripaludis S2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01877: RNA_binding
  • amino acids 3 to 100 (98 residues), 40.7 bits, E=1.3e-14

Best Hits

Swiss-Prot: 53% identical to Y1564_METJA: UPF0201 protein MJ1564 (MJ1564) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K09736, hypothetical protein (inferred from 100% identity to mmp:MMP1071)

Predicted SEED Role

"Dephospho-CoA kinase archaeal, predicted (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (7/9 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.24

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

See Q6LYC0 at UniProt or InterPro

Protein Sequence (139 amino acids)

>MMP_RS05540 hypothetical protein (Methanococcus maripaludis S2)
MIIKIKTKVKPTEDENKVLKAVTNIFNDAEMEISENIYTGVSKDISRFKELLRSQAILDA
ARNVLERNIVGNATKFHINKQAAYSGILNFDKDVHGGIKLEFICEEDEEILELIKDIAPR
TRDGIIINEDDEAIEKKNE