Protein Info for MMP_RS05525 in Methanococcus maripaludis S2

Annotation: calcium/sodium antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 36 to 62 (27 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details amino acids 106 to 142 (37 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details signal peptide" amino acids 27 to 27 (1 residues), see Phobius details TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 5 to 310 (306 residues), 217.3 bits, see alignment E=1.4e-68 PF01699: Na_Ca_ex" amino acids 5 to 144 (140 residues), 100.7 bits, see alignment E=3.9e-33 amino acids 163 to 314 (152 residues), 102.6 bits, see alignment E=1e-33

Best Hits

Swiss-Prot: 50% identical to Y091_METJA: Uncharacterized membrane protein MJ0091 (MJ0091) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07301, inner membrane protein (inferred from 100% identity to mmp:MMP1068)

Predicted SEED Role

"Uncharacterized membrane protein MJ0091"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYC3 at UniProt or InterPro

Protein Sequence (318 amino acids)

>MMP_RS05525 calcium/sodium antiporter (Methanococcus maripaludis S2)
MLIESVLFLAAGLFMLSYGSDWFVLGASRVAKQFNISSFVIGATIVAFGTSLPEIVTSAY
AASTGSVELAVGNALGSCIANIGLVLGLSLIISTVFIKNRSVLKNGYLYIIYTIIFTAIG
YNGFSFFDGIFLLFLLLVYVVYTIKSGEMDDEEHEKSITFKKAIIYLLIGLLFVILGSSF
FVDGAKGLASAFGVSEKIIGFTIVAFGTSLPELSVSFAAARQKLGGIVIGNVIGSNIANM
FGALAIASIIHEIPAVKFELSVNILMVLLLIAMMSKEKIKAVLNLNSTKEYLSKITKADG
LILILIYLLFVLGLTGIF