Protein Info for MMP_RS05520 in Methanococcus maripaludis S2

Annotation: succinate dehydrogenase/fumarate reductase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein" amino acids 6 to 214 (209 residues), 213.5 bits, see alignment E=1.3e-67 PF13085: Fer2_3" amino acids 11 to 95 (85 residues), 79.2 bits, see alignment E=9.9e-26 PF00111: Fer2" amino acids 16 to 71 (56 residues), 31.5 bits, see alignment 6.4e-11 PF13237: Fer4_10" amino acids 135 to 200 (66 residues), 35.2 bits, see alignment E=4.2e-12 PF13183: Fer4_8" amino acids 135 to 203 (69 residues), 41 bits, see alignment E=1e-13 PF13187: Fer4_9" amino acids 137 to 202 (66 residues), 30.9 bits, see alignment E=1e-10 PF12838: Fer4_7" amino acids 137 to 202 (66 residues), 29 bits, see alignment E=5.3e-10 PF13534: Fer4_17" amino acids 137 to 204 (68 residues), 34 bits, see alignment E=1.6e-11 PF02754: CCG" amino acids 265 to 348 (84 residues), 74 bits, see alignment E=3.7e-24 amino acids 380 to 465 (86 residues), 83.3 bits, see alignment E=4.8e-27

Best Hits

Swiss-Prot: 100% identical to Y1067_METMP: Uncharacterized iron-sulfur protein MMP1067 (MMP1067) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00245, fumarate reductase iron-sulfur protein [EC: 1.3.99.1] (inferred from 100% identity to mmp:MMP1067)

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYC4 at UniProt or InterPro

Protein Sequence (494 amino acids)

>MMP_RS05520 succinate dehydrogenase/fumarate reductase iron-sulfur subunit (Methanococcus maripaludis S2)
VKTFTITVKKTEGFKKFEVPVGLTILDALEYINKTYGENIQFRSSCKAGQCGSCAVMINK
KSKLACKTKVEDNMIIEPLEGFDVISDLVVDREPYYKKIGTLRNYIQKKNEKISEKELDG
LKLYPDDLKDVKKIRGCIDCLSCIAMCPARKYSNYPGPTLMRQLARFAFDPKDEIDREKE
AFDENIYNCTTCGRCVEVCPKEIDIVHNAVEKLREKTFKKGYNLDSHLEVRKNVLSQNRS
VPKEKTSFLEEVSDEYIVENEKMRVAFFTGCLVDFRLQEIGKSAIRVLNAHGVSVIIPKN
QVCCGSPFIRTGQTDISESLKKQNLEIFNKLNVDSVVTLCAGCGSTLKNDYKEKKFKVMD
ITEVLVKVGLIDYKPLDITVTYHDPCHLRRGQKVYLEPRKILESIPKLKFIEMEIPDQCC
GAGGGVRSGKPEVAEAIGKRKANMIYATDADYLITVCPFCEYHIRDSLTKYLKEHGLKKD
IPVMNIISLLDKVI