Protein Info for MMP_RS05485 in Methanococcus maripaludis S2

Annotation: cysteine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 TIGR00435: cysteine--tRNA ligase" amino acids 2 to 473 (472 residues), 561.7 bits, see alignment E=7.6e-173 PF01406: tRNA-synt_1e" amino acids 15 to 312 (298 residues), 460.6 bits, see alignment E=6.7e-142 PF09334: tRNA-synt_1g" amino acids 32 to 149 (118 residues), 32.3 bits, see alignment E=1.2e-11 amino acids 254 to 314 (61 residues), 31.7 bits, see alignment E=1.8e-11 PF00133: tRNA-synt_1" amino acids 222 to 298 (77 residues), 24.4 bits, see alignment E=3.1e-09 PF09190: DALR_2" amino acids 355 to 413 (59 residues), 43.2 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 100% identical to SYC_METMP: Cysteine--tRNA ligase (cysS) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 100% identity to mmp:MMP1060)

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYD1 at UniProt or InterPro

Protein Sequence (476 amino acids)

>MMP_RS05485 cysteine--tRNA ligase (Methanococcus maripaludis S2)
MLKVYNTLTRCEEEFKTLNEKEVKMYVCGPTVYDNTHLGHGRTYVSFDIIRRYLEHMGYT
VNLVINFTDIDDKIIKRAYEKEKDPKEISEQFIKVFLDDMATLKVKPADIYPKVTEHISE
IIAFIEKLIEKGFAYKTEDGVYFEVKKFKNYGKLSNINLEDLVSGARIETSEKKKNQKDF
ALWKTAKPGEPKWESPFGSGRPGWHIECSAMSSKYLGEQFDIHGGGRDLSFPHHENEIAQ
SSAYSGKDWVNYWLHTGFVMVNGEKMSKSLGNFVTIGDISKEYSPEILRFFFIQRHYRSP
IDYTAESMNHVKNNLEKIYNVIENIRISLEKSEKSRTWDENEFLLYDILKNSKNNFYNAM
NSDFNTVKALKSVFEVSNGVNKYLSLTKTPSEGLLLKALDFYKIIGEIFGLFENYFKESS
DSDEEEFVTFLIELRSDVRLQKNYEMSDKIRDGLKNLGYQIEDNPKEGTVFKKINI