Protein Info for MMP_RS05455 in Methanococcus maripaludis S2

Annotation: DUF167 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 TIGR00251: TIGR00251 family protein" amino acids 6 to 91 (86 residues), 90.4 bits, see alignment E=3.4e-30 PF02594: DUF167" amino acids 12 to 82 (71 residues), 76.1 bits, see alignment E=9.7e-26

Best Hits

Swiss-Prot: 99% identical to Y1055_METMP: UPF0235 protein MMP1055 (MMP1055) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K09131, hypothetical protein (inferred from 99% identity to mmp:MMP1055)

Predicted SEED Role

"UPF0235 protein MJ0618"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYD6 at UniProt or InterPro

Protein Sequence (101 amino acids)

>MMP_RS05455 DUF167 domain-containing protein (Methanococcus maripaludis S2)
LIEKMVKESEKGILIDIEVTTNAKKNEIGKINEWRKRIEIRIKEQPIEGKANKAIIKFLK
GIFKSEILINSGTTSSQKTVLIPDKTKDDVVTILKKEIKSI