Protein Info for MMP_RS05425 in Methanococcus maripaludis S2

Annotation: monovalent cation/H+ antiporter complex subunit F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 57 (26 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details PF04066: MrpF_PhaF" amino acids 38 to 81 (44 residues), 24.9 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 30% identical to Y1250_METTH: Uncharacterized protein MTH_1250 (MTH_1250) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K14111, energy-converting hydrogenase B subunit B (inferred from 98% identity to mmz:MmarC7_0303)

Predicted SEED Role

"Energy conserving hydrogenase Ehb protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYE2 at UniProt or InterPro

Protein Sequence (89 amino acids)

>MMP_RS05425 monovalent cation/H+ antiporter complex subunit F (Methanococcus maripaludis S2)
MNEYVLYFTMISLVFGAFSALKLAFRKETSNVLIGEGLMAVIIATFLVILAEIYSIAYVE
TVALLLLVCGPIGTIAFSKFMKKGNPAEV