Protein Info for MMP_RS05295 in Methanococcus maripaludis S2

Annotation: minichromosome maintenance protein MCM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 710 PF17207: MCM_OB" amino acids 106 to 213 (108 residues), 54.7 bits, see alignment E=2.7e-18 PF00493: MCM" amino acids 269 to 491 (223 residues), 249.7 bits, see alignment E=5.5e-78 PF07728: AAA_5" amino acids 325 to 442 (118 residues), 31.4 bits, see alignment E=5.5e-11 PF01078: Mg_chelatase" amino acids 371 to 442 (72 residues), 29.1 bits, see alignment E=1.9e-10 PF17855: MCM_lid" amino acids 547 to 619 (73 residues), 68.5 bits, see alignment E=1.8e-22 PF21100: WHD_MCM" amino acids 642 to 709 (68 residues), 30.3 bits, see alignment E=8.8e-11

Best Hits

KEGG orthology group: K10726, replicative DNA helicase Mcm [EC: 3.6.4.-] (inferred from 100% identity to mmp:MMP1024)

Predicted SEED Role

"DNA replication helicase protein MCM" in subsystem DNA replication, archaeal

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYG7 at UniProt or InterPro

Protein Sequence (710 amino acids)

>MMP_RS05295 minichromosome maintenance protein MCM (Methanococcus maripaludis S2)
MEFDEEVFLTLYGDKLKKYMKDQISQKMVKNNVFEFDIGEFLKNYSDSCDINDQIIENPK
LVEDPLLYVFKESYIDLFGEDEHVKKELEKTQIAFKNPLGCDKKIDEITSSEMNRLVKFE
GNIIKAAKVCALLKKACFVCRACGEISYKTIHDYFEQPRSYCKNQNCRSEMSIDYDSSAY
VNIQELEIQQPIDLMRNPDDPPRSIRVFLENSDGIYSGRVDVVGTVMKKLTRPNMPVFEI
YAKSNHVKLGESFQKIEVKDIINNYDLINTLDELGKKENIIDILSNYLIPQIKGYDLVKK
SIFLQQVKACTKFLPDGSELRKDSHILLITDPGIGKSTMLRKISRLFPQNSYASVTTATG
GGLTANVVREATEIGDGWVVKPGVFVRANEGTACIDELTVDKNVMKYILEAMESQTIHVN
KGGINVKLPARCAVLAACNPKRGRFDRNMGVVEQIGIPAPLLSRFDLIFPLKDSPDRRRD
AEIAEHILDTHVETATKNYSKVLGSIKVDGITVDENLIKNYIIYARTCAYFDENHHLYAG
EVDERKIKSPPLSKGAKKLIRDYYVDMRKLGEGNNPVPVTARQLEAAIRISEMHAKARLS
RKVEEKDAKIAIDIIEECLRQVAYDPETGKFDIDKGMGEIPKSKVDKMDKIVDIIRELSV
LSSNGLADECDIVEKASEFQISEKDVSDMLSKLKKSADVFSPKYGYYRLT