Protein Info for MMP_RS05285 in Methanococcus maripaludis S2

Annotation: MMPL family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 305 to 333 (29 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details PF03176: MMPL" amino acids 48 to 366 (319 residues), 129.8 bits, see alignment E=1.7e-41 PF02355: SecD_SecF" amino acids 214 to 354 (141 residues), 28.4 bits, see alignment E=1.5e-10 PF02460: Patched" amino acids 236 to 370 (135 residues), 27.9 bits, see alignment E=1.1e-10

Best Hits

Swiss-Prot: 54% identical to Y1562_METJA: Putative membrane protein MJ1562 (MJ1562) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07003, (no description) (inferred from 100% identity to mmp:MMP1022)

Predicted SEED Role

"Putative membrane protein MJ1562"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYG9 at UniProt or InterPro

Protein Sequence (388 amino acids)

>MMP_RS05285 MMPL family transporter (Methanococcus maripaludis S2)
MKAEKILQKIAEASERHPLKVVAVVIVLTIFMAFLATGIESQTDYEKMVPQDDPVIVALN
EIRDEFGGTETIMLGVKLVPSDSSEKVTDIRDPRVLDLVDFLEQDIGSMDMITSVSSRAD
ILKAYNNDVIPNDVATVKTIYQNLPESSRDGIFNNDYSMVVVYATTDAGTDDKKILVKDI
NSRLDEAPIPPGVEVITTGTPALSELLKRMMDESQAVTGLASLLAIFTILLLYFRNIVKS
VLPLIPVVVAVIWAAGSMAIFKIPMDTATSVMGSLLLGLGIDYGVHLFHRYEEELGDGKS
MDEAINIAVVSTGSAVLVTTATTMAGFAALTIAPLSMMANMGKVCTLGIFFCMAAVICLL
PPLIVIEERYTRPFLKKLTLKLKGESNE