Protein Info for MMP_RS05260 in Methanococcus maripaludis S2

Annotation: aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 TIGR00656: aspartate kinase, monofunctional class" amino acids 2 to 463 (462 residues), 475.7 bits, see alignment E=1.3e-146 TIGR00657: aspartate kinase" amino acids 3 to 462 (460 residues), 478.5 bits, see alignment E=2.3e-147 PF00696: AA_kinase" amino acids 3 to 287 (285 residues), 183.9 bits, see alignment E=8.1e-58 PF22468: ACT_9" amino acids 321 to 383 (63 residues), 60.5 bits, see alignment E=2.2e-20 amino acids 401 to 461 (61 residues), 83.5 bits, see alignment E=1.4e-27 PF13840: ACT_7" amino acids 397 to 459 (63 residues), 31.3 bits, see alignment E=2.9e-11

Best Hits

Swiss-Prot: 67% identical to AK_METJA: Probable aspartokinase (MJ0571) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to mmp:MMP1017)

MetaCyc: 67% identical to aspartate kinase monomer (Methanocaldococcus jannaschii)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYH4 at UniProt or InterPro

Protein Sequence (468 amino acids)

>MMP_RS05260 aspartate kinase (Methanococcus maripaludis S2)
LVTVMKFGGTSVGNGDRIRNVAKIVVNKTNEDNDVVVVTSAMTQVTNSLVEISAQALDVR
DIAKINNFIEDLRRKHEIAIEQAIENHEIRVEVSKTIESSINELEKVLVGVSYLGELTPK
SKDFILSFGERLSAPILSGAIRDMGKHSLYLAGRDAGIITDDNFTCAKVLRLEVSEKIKP
LLKDGFIPIVTGFVAGTEEGHITTLGRGGSDYSAALVGLGLTADMVEIWTDVSGVLSADP
RMVENVKQIPKMSYIEAMELAYFGAKVLHPRTMEPVMEKKIPLRIKNTFEPENEGTLITD
SSETSNGIIKAITTIKDVILINIFGGGMVGVSGTAARIFNVLGKSNANVILITQGSSETN
ISIVIYDGELEAKKCVRELRDEFGECHLIKDITFDKEVCVVSVVGSGMKGAKGIAGKLFE
AVSESGANIKMIAQGSSETNISFVINEDKLEPCLKTLHKTFVEDEINF