Protein Info for MMP_RS05250 in Methanococcus maripaludis S2

Annotation: NFYB/HAP3 family transcription factor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 PF00808: CBFD_NFYB_HMF" amino acids 2 to 62 (61 residues), 44.2 bits, see alignment E=9.6e-16

Best Hits

Swiss-Prot: 84% identical to HMVA_METVO: DNA-binding protein HmvA (hmvA) from Methanococcus voltae

KEGG orthology group: None (inferred from 96% identity to mmq:MmarC5_0579)

Predicted SEED Role

"DNA-binding protein hmvA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYH6 at UniProt or InterPro

Protein Sequence (99 amino acids)

>MMP_RS05250 NFYB/HAP3 family transcription factor subunit (Methanococcus maripaludis S2)
MIPKGTVKRIMKENTDMNVSAESVVALVEILQEMVVTTTKIAEENAAKDKRKTLKARDIE
QCDAERLRKKVIEVSERTEKVNMLTNEILNVIANELERY