Protein Info for MMP_RS05140 in Methanococcus maripaludis S2

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 66 PF13443: HTH_26" amino acids 4 to 65 (62 residues), 37.4 bits, see alignment E=2.5e-13 PF01381: HTH_3" amino acids 5 to 59 (55 residues), 59.3 bits, see alignment E=3.2e-20

Best Hits

Swiss-Prot: 71% identical to Y1627_ARCFU: Uncharacterized HTH-type transcriptional regulator AF_1627 (AF_1627) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K07729, putative transcriptional regulator (inferred from 100% identity to mmp:MMP0993)

Predicted SEED Role

"Transcriptional regulator, Hth-3 family" in subsystem Ketoisovalerate oxidoreductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYJ8 at UniProt or InterPro

Protein Sequence (66 amino acids)

>MMP_RS05140 helix-turn-helix transcriptional regulator (Methanococcus maripaludis S2)
MKTRIKEYRAKYDMTQEDLGKIVGVRRETIGFLEKGKYNPSLKLAHAISKALNVKIDDLF
IFEEDE