Protein Info for MMP_RS05095 in Methanococcus maripaludis S2

Annotation: CO dehydrogenase/acetyl-CoA synthase complex subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02552: CO_dh
  • amino acids 5 to 169 (165 residues), 173.3 bits, E=1.9e-55
• TIGR00315: CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit
  • amino acids 9 to 169 (161 residues), 208.3 bits, E=3.5e-66

Best Hits

Swiss-Prot: 64% identical to ACDE_METTH: Acetyl-CoA decarbonylase/synthase complex subunit epsilon (cdhB) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00195, acetyl-CoA decarbonylase/synthase complex subunit epsilon (inferred from 100% identity to mmp:MMP0984)

Predicted SEED Role

"CO dehydrogenase/acetyl-CoA synthase subunit epsilon, CO dehydrogenase subcomplex (EC 1.2.99.2)" in subsystem Carbon monoxide induced hydrogenase (EC 1.2.99.2)

KEGG Metabolic Maps

• Methane metabolism
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.2

Use Curated BLAST to search for 1.2.99.2

Sequence Analysis Tools

See Q6LYK7 at UniProt or InterPro

Protein Sequence (172 amino acids)

>MMP_RS05095 CO dehydrogenase/acetyl-CoA synthase complex subunit epsilon (Methanococcus maripaludis S2)
MDGDRTTPWQPTVIAGPKHGMLVTPAIAKMMLKKAKNPLFVIGPLIKDDEELISLCKSIV
EAWNLPVVATGNIYKSLTEKGIKSKRYGTIEIVNLLKDSEWKGINGEGSYDLVLFIGVTY
YLASQGLSSLKHFAPHLKTVTLCKYFHSNADASFPNMSDSEWTNYLEKMSKI