Protein Info for MMP_RS05090 in Methanococcus maripaludis S2

Annotation: CO dehydrogenase/CO-methylating acetyl-CoA synthase complex subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00316: CO dehydrogenase/CO-methylating acetyl-CoA synthase complex, beta subunit
  • amino acids 1 to 456 (456 residues), 770.2 bits, E=3.7e-236
• PF03598: CdhC
  • amino acids 5 to 156 (152 residues), 218.6 bits, E=3.9e-69
• PF19436: ACS_CODH_B_C
  • amino acids 167 to 397 (231 residues), 272.2 bits, E=4.5e-85

Best Hits

Swiss-Prot: 68% identical to ACDB_METTH: Acetyl-CoA decarbonylase/synthase complex subunit beta (cdhC) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00193, acetyl-CoA decarbonylase/synthase complex subunit beta [EC: 2.3.1.-] (inferred from 100% identity to mmp:MMP0983)

MetaCyc: 55% identical to acetyl-CoA decarbonylase/synthase complex beta subunit (Methanosarcina thermophila)
2.3.3.M4 [EC: 2.3.3.M4]; 2.3.1.169,2.3.3.M4,2.3.3.M4,2.3.3.M5 [EC: 2.3.3.M4, 2.3.1.169, 2.3.3.M5]

Predicted SEED Role

"CO dehydrogenase/acetyl-CoA synthase subunit beta, acetyl-CoA synthase (EC 2.3.1.169)" in subsystem Carbon monoxide induced hydrogenase (EC 2.3.1.169)

MetaCyc Pathways

• gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (5/6 steps found)
• carbon tetrachloride degradation II (4/6 steps found)
• methanogenesis from acetate (4/6 steps found)
• hydrogen production VI (1/2 steps found)
• methoxylated aromatic compound degradation II (6/9 steps found)
• superpathway of methanogenesis (11/21 steps found)
• reductive acetyl coenzyme A pathway I (homoacetogenic bacteria) (3/10 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Methane metabolism
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.169 or 2.3.3.M4 or 2.3.3.M5

Sequence Analysis Tools

See Q6LYK8 at UniProt or InterPro

Protein Sequence (457 amino acids)

>MMP_RS05090 CO dehydrogenase/CO-methylating acetyl-CoA synthase complex subunit beta (Methanococcus maripaludis S2)
MFGDIPVEISPMYEGERIRAANMFVELAGPKSVGAELVLVSDDVEDGKIEVIGPELKDME
EGKKYPFGILMEVSGEKLEKDLEGVIERRIHEICNYVQGFMHLNQRDKIWCRIGKDSHAK
GFELKHLGQALSTLFKDEFPIIEAISITIFTEEEKVKEFVEKAVSEYQARDSKARDLSEE
DVDVFYGCIMCQSFAPTHVCIITPDRPALCGGINWFDCRAAAKIDPEGPIFEIPKGDLLD
PVSGEYTTLNATVADKSQSTFDKVYLHSIFGHPHTSCGCFEAVAFYIPEVDGIGIVHRDF
KGDTPMGIPFSAMAGQCSGGKQVEGFAGLCVEYMRSPKFLQADGGYERIVWLPKEIKEKV
LESIPEELRDKIATEEDVSSIHNLKKFLNEKDHPVLKRIAELDAPFEEQVVETEAEPAGE
FVQFAQIPEMAIPTSGGIKIILKNAKIYAEKIIIKKK