Protein Info for MMP_RS05075 in Methanococcus maripaludis S2

Annotation: acetyl-CoA decarbonylase/synthase complex subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF04060: FeS" amino acids 12 to 43 (32 residues), 51.3 bits, see alignment (E = 7.4e-18) PF03599: CdhD" amino acids 63 to 452 (390 residues), 494.4 bits, see alignment E=2e-152

Best Hits

Swiss-Prot: 63% identical to ACDG_METTH: Acetyl-CoA decarbonylase/synthase complex subunit gamma (cdhE) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00197, acetyl-CoA decarbonylase/synthase complex subunit gamma [EC: 2.1.1.-] (inferred from 100% identity to mmp:MMP0980)

MetaCyc: 42% identical to acetyl-CoA decarbonylase/synthase complex gamma subunit (Methanosarcina thermophila)
2.1.1.245,2.3.3.M4 [EC: 2.1.1.245, 2.3.3.M4]

Predicted SEED Role

"5-tetrahydromethanopterin:corrinoid iron-sulfur protein methyltransferase / CO dehydrogenase/acetyl-CoA synthase subunit gamma, corrinoid iron-sulfur subcomplex large subunit" in subsystem Carbon monoxide induced hydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.245 or 2.3.3.M4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYL1 at UniProt or InterPro

Protein Sequence (457 amino acids)

>MMP_RS05075 acetyl-CoA decarbonylase/synthase complex subunit gamma (Methanococcus maripaludis S2)
VKVTAMDIYKLLPKTNCGKCGEASCMAFAAKLSQKEAELSACPQLKGADFEKLANMLAPA
VREIKIGTGDRAVTIGGDEVLYRYELTYYNPTAVAVDLSDDMDDSAFDQKLVKIKNLEFE
RTGEILKLNAVALRNKSGDAEKFKKAAEKLKDSEIPVILCSFDPKAMDAALDVIGSKRPL
IYAATENNIDEMSELALKHNCPISLFVPNDLEKMKQLSRKLRESGVKDIVLDPGTYIGEA
IGDTMDNFIMIRRLAVEEKDDDFRFPILAVPAVCWINPEEDEILTKMKEATTAAALMNRY
ADVMILHGVDIWEMMPVLTLRQSLYTDPRKPQSVEAKIYEFGTVDENSPVIMTTNFALTY
YTVAGDLKSGKVNCYLLVLDTNGKAVDVAVAGGQFNGKAAAELMKETGIEKLVNHKKLII
PGLAASVSGDIEDQSGWEVIVGTRDSSEVPAFLAKIW