Protein Info for MMP_RS05075 in Methanococcus maripaludis S2

Annotation: acetyl-CoA decarbonylase/synthase complex subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04060: FeS
  • amino acids 12 to 43 (32 residues), 51.8 bits, see alignment (E = 5.1e-18)
• PF03599: CdhD
  • amino acids 63 to 452 (390 residues), 494.4 bits, E=2e-152

Best Hits

Swiss-Prot: 63% identical to ACDG_METTH: Acetyl-CoA decarbonylase/synthase complex subunit gamma (cdhE) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00197, acetyl-CoA decarbonylase/synthase complex subunit gamma [EC: 2.1.1.-] (inferred from 100% identity to mmp:MMP0980)

MetaCyc: 42% identical to acetyl-CoA decarbonylase/synthase complex gamma subunit (Methanosarcina thermophila)
2.1.1.245,2.3.3.M4 [EC: 2.1.1.245, 2.3.3.M4]

Predicted SEED Role

"5-tetrahydromethanopterin:corrinoid iron-sulfur protein methyltransferase / CO dehydrogenase/acetyl-CoA synthase subunit gamma, corrinoid iron-sulfur subcomplex large subunit" in subsystem Carbon monoxide induced hydrogenase

MetaCyc Pathways

• gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (5/6 steps found)
• carbon tetrachloride degradation II (4/6 steps found)
• methanogenesis from acetate (4/6 steps found)
• hydrogen production VI (1/2 steps found)
• methoxylated aromatic compound degradation II (6/9 steps found)
• superpathway of methanogenesis (11/21 steps found)
• reductive acetyl coenzyme A pathway I (homoacetogenic bacteria) (3/10 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.245 or 2.3.3.M4

Sequence Analysis Tools

See Q6LYL1 at UniProt or InterPro

Protein Sequence (457 amino acids)

>MMP_RS05075 acetyl-CoA decarbonylase/synthase complex subunit gamma (Methanococcus maripaludis S2)
VKVTAMDIYKLLPKTNCGKCGEASCMAFAAKLSQKEAELSACPQLKGADFEKLANMLAPA
VREIKIGTGDRAVTIGGDEVLYRYELTYYNPTAVAVDLSDDMDDSAFDQKLVKIKNLEFE
RTGEILKLNAVALRNKSGDAEKFKKAAEKLKDSEIPVILCSFDPKAMDAALDVIGSKRPL
IYAATENNIDEMSELALKHNCPISLFVPNDLEKMKQLSRKLRESGVKDIVLDPGTYIGEA
IGDTMDNFIMIRRLAVEEKDDDFRFPILAVPAVCWINPEEDEILTKMKEATTAAALMNRY
ADVMILHGVDIWEMMPVLTLRQSLYTDPRKPQSVEAKIYEFGTVDENSPVIMTTNFALTY
YTVAGDLKSGKVNCYLLVLDTNGKAVDVAVAGGQFNGKAAAELMKETGIEKLVNHKKLII
PGLAASVSGDIEDQSGWEVIVGTRDSSEVPAFLAKIW