Protein Info for MMP_RS05070 in Methanococcus maripaludis S2

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF13247: Fer4_11" amino acids 37 to 125 (89 residues), 42 bits, see alignment E=3.6e-14 PF12797: Fer4_2" amino acids 67 to 86 (20 residues), 25.1 bits, see alignment (E = 4.9e-09) PF13237: Fer4_10" amino acids 67 to 118 (52 residues), 27.8 bits, see alignment E=7.8e-10 PF00037: Fer4" amino acids 68 to 90 (23 residues), 34 bits, see alignment 7.3e-12 PF12837: Fer4_6" amino acids 68 to 89 (22 residues), 29.5 bits, see alignment 2e-10 PF12798: Fer4_3" amino acids 74 to 88 (15 residues), 17.6 bits, see alignment (E = 2.2e-06)

Best Hits

Swiss-Prot: 49% identical to FER8_METJA: Uncharacterized ferredoxin MJ0155 (MJ0155) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 100% identity to mmp:MMP0979)

Predicted SEED Role

"Iron-sulfur protein clustered with CO dehydrogenase/acetyl-CoA synthase" in subsystem Carbon monoxide induced hydrogenase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYL2 at UniProt or InterPro

Protein Sequence (154 amino acids)

>MMP_RS05070 4Fe-4S dicluster domain-containing protein (Methanococcus maripaludis S2)
MKSLMVVDARKCTECNDCIEACKKQHGVARAIKTQSIPMFCLQCHPDKAPCKQVCPVNAI
EELDGALVVNEESCILCRLCMVACPVGALTINKDAKSVQKCTLCMETDRMLPACVEACKS
NVLKLFSVEDLEELKREKSHMDVVIESLKMYRDE