Protein Info for MMP_RS05000 in Methanococcus maripaludis S2

Annotation: FmdE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF02663: FmdE" amino acids 11 to 142 (132 residues), 152 bits, see alignment E=1e-48 PF01258: zf-dskA_traR" amino acids 156 to 190 (35 residues), 37.6 bits, see alignment 1.8e-13

Best Hits

KEGG orthology group: K11261, formylmethanofuran dehydrogenase subunit E [EC: 1.2.99.5] (inferred from 100% identity to mmp:MMP0965)

Predicted SEED Role

"Uncharacterized protein MA0381"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.5

Use Curated BLAST to search for 1.2.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYM5 at UniProt or InterPro

Protein Sequence (192 amino acids)

>MMP_RS05000 FmdE family protein (Methanococcus maripaludis S2)
LNEDYQKTIEFHGHECPGVTIGYRVSKYVLDHYERSEDEQLVAIVENNSCSIDGIQQMLG
CTFGKGNLKFKDNGKHVYTFYSRGNDKALRIYLKYNLAEKVGNFNKKFNEGTLTAEDEKQ
MFERRKEAIKHLMEAPEEELFDVQWVEIEEPKKARLYPSLTCENCGETFMEIKGRTIDGK
IVCKECFQKLVH