Protein Info for MMP_RS04960 in Methanococcus maripaludis S2

Annotation: cytochrome c biogenesis CcdA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 67 (27 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 122 to 151 (30 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details PF02683: DsbD_TM" amino acids 3 to 191 (189 residues), 76.5 bits, see alignment E=1.9e-25 PF13386: DsbD_2" amino acids 6 to 211 (206 residues), 40.6 bits, see alignment E=2.8e-14

Best Hits

KEGG orthology group: K06196, cytochrome c-type biogenesis protein (inferred from 100% identity to mmp:MMP0957)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcdA (DsbD analog)" in subsystem Biogenesis of c-type cytochromes or Experimental tye or Periplasmic disulfide interchange or Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYN3 at UniProt or InterPro

Protein Sequence (217 amino acids)

>MMP_RS04960 cytochrome c biogenesis CcdA family protein (Methanococcus maripaludis S2)
MDLFLIFLAGISTALGPCIVTVLPFVLAYTFGISNSRFEGFLVSFSFMVGFSIVFSTLGV
LSSAFGIFLNFTLLKYIAGSFAIIFGILVLFNKNFTFRKEGVFQKFSKKLSNMNDISLHV
KILNSIVLGIVYGFGANICADPILAGILTFVASKADVYYGFFALLTYSLGYGIPIIFLST
LGAESKQIVEKIVKKKFITYISGIILIILGLFLIFSV