Protein Info for MMP_RS04935 in Methanococcus maripaludis S2

Annotation: translation initiation factor IF-5A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 TIGR00037: translation elongation factor IF5A" amino acids 2 to 128 (127 residues), 154.8 bits, see alignment E=5.2e-50 PF21485: IF5A-like_N" amino acids 4 to 63 (60 residues), 61.8 bits, see alignment E=6.7e-21

Best Hits

Swiss-Prot: 100% identical to IF5A_METMP: Translation initiation factor 5A (eif5a) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03263, translation initiation factor 5A (inferred from 100% identity to mmp:MMP0952)

Predicted SEED Role

"Eukaryotic translation initiation factor 5A" in subsystem Translation initiation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYN8 at UniProt or InterPro

Protein Sequence (131 amino acids)

>MMP_RS04935 translation initiation factor IF-5A (Methanococcus maripaludis S2)
MAGTKPSELGALKVGQYVVIDGIACRVMDTAHSKPGKHGGAKVRLTAMGIFEPVKKEHVG
PASSRIDVPLIDKRKGQVLALMGEHVQIMDLETYETLELPMPTDVEGIDSGVEVEYFEAM
DRYKITRVISK