Protein Info for MMP_RS04915 in Methanococcus maripaludis S2

Annotation: UPF0058 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 PF01893: UPF0058" amino acids 1 to 86 (86 residues), 104.6 bits, see alignment E=1.3e-34

Best Hits

Swiss-Prot: 48% identical to Y1132_METJA: UPF0058 protein MJ1132 (MJ1132) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0948)

Predicted SEED Role

"UPF0058 protein MJ1132"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYP2 at UniProt or InterPro

Protein Sequence (118 amino acids)

>MMP_RS04915 UPF0058 family protein (Methanococcus maripaludis S2)
MHKEQLMELHQFFVHVFKEMIPEGTDCVYLKTYEELDVKPHHIHKLKTEQRAAIFLLAAC
LAEGLSQRDDSIPENLSKRLSENAFKYINMQSEKYQNLKKVKNSIDVQCKHENVKNTV