Protein Info for MMP_RS04890 in Methanococcus maripaludis S2

Annotation: adenylyltransferase/cytidyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 5 to 69 (65 residues), 72.9 bits, E=9.1e-25
• PF01467: CTP_transf_like
  • amino acids 8 to 136 (129 residues), 73.3 bits, E=1.2e-24

Best Hits

Swiss-Prot: 100% identical to RIBL_METMP: FAD synthase (ribL) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K14656, FAD synthetase (inferred from 100% identity to mmp:MMP0943)

MetaCyc: 68% identical to FAD synthetase monomer (Methanocaldococcus jannaschii)
FAD synthetase. [EC: 2.7.7.2]

Predicted SEED Role

"FMN adenylyltransferase, type 3 archaeal (EC 2.7.7.2)" (EC 2.7.7.2)

MetaCyc Pathways

• flavin biosynthesis II (archaea) (8/10 steps found)
• flavin salvage (1/2 steps found)
• flavin biosynthesis I (bacteria and plants) (6/9 steps found)
• flavin biosynthesis III (fungi) (5/9 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.2

Sequence Analysis Tools

See Q6LYP5 at UniProt or InterPro

Protein Sequence (150 amino acids)

>MMP_RS04890 adenylyltransferase/cytidyltransferase family protein (Methanococcus maripaludis S2)
MEKKIAVTAGTFDLLHPGHFNTLNFAKKHADELVVIIARDETVKKIKGRSPVIPEEQRKI
MIEALKPVDRAVLGSLTNKLEPILEIRPDVIVLGPDQTTYQINELKAQLAEHSLYPEILK
VEDYVKCPFHSSYDILKEIVRRWCCKELKV