Protein Info for MMP_RS04850 in Methanococcus maripaludis S2

Annotation: UPF0254 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF06787: HcgF" amino acids 1 to 158 (158 residues), 208.2 bits, see alignment E=3.5e-66

Best Hits

Swiss-Prot: 100% identical to Y935_METMP: UPF0254 protein MMP0935 (MMP0935) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0935)

Predicted SEED Role

"UPF0254 protein MTH_1148"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYQ3 at UniProt or InterPro

Protein Sequence (165 amino acids)

>MMP_RS04850 UPF0254 family protein (Methanococcus maripaludis S2)
MISVATAECFTHGKIGTKIHKIACGYKEFEKDSNYDMIHGNVYVMASMFLPSKKGIESLL
DVNLPKPDYVFKYSKAYNQENDILVAKLVAKALKNKLNCNIAISSTAGIGNGAVCIVTDY
NDYVFSSDIYGDLLKGQNIIKRQESGIEKAYNTFIDILKKEYNLK