Protein Info for MMP_RS04790 in Methanococcus maripaludis S2

Annotation: 4-hydroxy-tetrahydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase
  • amino acids 1 to 268 (268 residues), 339.6 bits, E=7.5e-106
• PF01113: DapB_N
  • amino acids 2 to 131 (130 residues), 116.4 bits, E=9.1e-38
• PF05173: DapB_C
  • amino acids 134 to 267 (134 residues), 155.3 bits, E=8.8e-50

Best Hits

Swiss-Prot: 100% identical to DAPB_METMP: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 100% identity to mmp:MMP0923)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (14/15 steps found)
• L-lysine biosynthesis VI (7/7 steps found)
• L-lysine biosynthesis I (8/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• aspartate superpathway (18/25 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

See Q6LYR5 at UniProt or InterPro

Protein Sequence (270 amino acids)

>MMP_RS04790 4-hydroxy-tetrahydrodipicolinate reductase (Methanococcus maripaludis S2)
MVKVAVTGALGRMGSGIIKTITETDGLDVVAAIDIPNHPKKGQDVGELTGLGKIGVALST
SDELEAVLKESGAEVLVDFTAAAPCVQTAKTASKLGVNLVIGTTGFTPEQRAEMEDAISK
NKVAATISQNYAVGVNIFFKTLELLAQKLGDYDIEILEMHHKFKKDAPSGTALRAAEIIQ
NNLNRDSNVIYGREGITGERTKEEICIHALRGGDIVGDHSVIFTTEGERLELSHRVTSRQ
SLVSGAVLAIKFVAQKKEGIYNTFDVLDLN